Anti EIF4E pAb (ATL-HPA068358)

Atlas Antibodies

SKU: ATL-HPA068358-25

• 
• 

Protein Description: eukaryotic translation initiation factor 4E
Gene Name: EIF4E
Alternative Gene Name: EIF4E1, EIF4EL1, EIF4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028156: 92%, ENSRNOG00000052343: 92%
Entrez Gene ID: 1977
Uniprot ID: P06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP
• Gene Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP
• Gene ID - Mouse: ENSMUSG00000028156
• Gene ID - Rat: ENSRNOG00000052343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.