![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100207/180019/atl-hpa068358_anti-eif4e-pab-atl-hpa068358_61682__10978.1681135902.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: eukaryotic translation initiation factor 4E
Gene Name: EIF4E
Alternative Gene Name: EIF4E1, EIF4EL1, EIF4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028156: 92%, ENSRNOG00000052343: 92%
Entrez Gene ID: 1977
Uniprot ID: P06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF4E
Alternative Gene Name: EIF4E1, EIF4EL1, EIF4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028156: 92%, ENSRNOG00000052343: 92%
Entrez Gene ID: 1977
Uniprot ID: P06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP |
| Documents & Links for Anti EIF4E pAb (ATL-HPA068358) | |
| Datasheet | Anti EIF4E pAb (ATL-HPA068358) Datasheet (External Link) |
| Vendor Page | Anti EIF4E pAb (ATL-HPA068358) at Atlas |
| Documents & Links for Anti EIF4E pAb (ATL-HPA068358) | |
| Datasheet | Anti EIF4E pAb (ATL-HPA068358) Datasheet (External Link) |
| Vendor Page | Anti EIF4E pAb (ATL-HPA068358) |