Anti EIF4E pAb (ATL-HPA068358)
Atlas Antibodies
- SKU:
- ATL-HPA068358-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: EIF4E
Alternative Gene Name: EIF4E1, EIF4EL1, EIF4F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028156: 92%, ENSRNOG00000052343: 92%
Entrez Gene ID: 1977
Uniprot ID: P06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP |
Gene Sequence | MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP |
Gene ID - Mouse | ENSMUSG00000028156 |
Gene ID - Rat | ENSRNOG00000052343 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF4E pAb (ATL-HPA068358) | |
Datasheet | Anti EIF4E pAb (ATL-HPA068358) Datasheet (External Link) |
Vendor Page | Anti EIF4E pAb (ATL-HPA068358) at Atlas Antibodies |
Documents & Links for Anti EIF4E pAb (ATL-HPA068358) | |
Datasheet | Anti EIF4E pAb (ATL-HPA068358) Datasheet (External Link) |
Vendor Page | Anti EIF4E pAb (ATL-HPA068358) |