Anti EIF4B pAb (ATL-HPA046164)

Atlas Antibodies

SKU: ATL-HPA046164-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 4B
Gene Name: EIF4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058655: 97%, ENSRNOG00000010103: 97%
Entrez Gene ID: 1975
Uniprot ID: P23588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
• Gene Sequence: TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
• Gene ID - Mouse: ENSMUSG00000058655
• Gene ID - Rat: ENSRNOG00000010103
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.