Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045446-100
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis using Anti-EIF3K antibody HPA045446 (A) shows similar pattern to independent antibody HPA054590 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit K
Gene Name: EIF3K
Alternative Gene Name: ARG134, eIF3k, EIF3S12, HSPC029, M9, PLAC-24, PRO1474, PTD001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053565: 100%, ENSRNOG00000020495: 78%
Entrez Gene ID: 27335
Uniprot ID: Q9UBQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
Gene Sequence MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
Gene ID - Mouse ENSMUSG00000053565
Gene ID - Rat ENSRNOG00000020495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation)
Datasheet Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation)
Datasheet Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation)