Anti EIF3J pAb (ATL-HPA050977 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050977-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 3, subunit J
Gene Name: EIF3J
Alternative Gene Name: eIF3-alpha, eIF3-p35, eIF3j, EIF3S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043424: 92%, ENSRNOG00000016459: 92%
Entrez Gene ID: 8669
Uniprot ID: O75822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED
• Gene Sequence: DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED
• Gene ID - Mouse: ENSMUSG00000043424
• Gene ID - Rat: ENSRNOG00000016459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.