Anti EIF3F pAb (ATL-HPA049250 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049250-25

• 
• 

Protein Description: eukaryotic translation initiation factor 3, subunit F
Gene Name: EIF3F
Alternative Gene Name: eIF3-epsilon, eIF3-p47, eIF3f, EIF3S5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031029: 100%, ENSRNOG00000015221: 100%
Entrez Gene ID: 8665
Uniprot ID: O00303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA
• Gene Sequence: DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA
• Gene ID - Mouse: ENSMUSG00000031029
• Gene ID - Rat: ENSRNOG00000015221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.