Anti EIF3C pAb (ATL-HPA050112)

Atlas Antibodies

SKU:
ATL-HPA050112-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit C
Gene Name: EIF3C
Alternative Gene Name: eIF3-p110, eIF3c, EIF3S8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030738: 95%, ENSRNOG00000018761: 95%
Entrez Gene ID: 8663
Uniprot ID: Q99613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE
Gene Sequence NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE
Gene ID - Mouse ENSMUSG00000030738
Gene ID - Rat ENSRNOG00000018761
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3C pAb (ATL-HPA050112)
Datasheet Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link)
Vendor Page Anti EIF3C pAb (ATL-HPA050112) at Atlas Antibodies

Documents & Links for Anti EIF3C pAb (ATL-HPA050112)
Datasheet Anti EIF3C pAb (ATL-HPA050112) Datasheet (External Link)
Vendor Page Anti EIF3C pAb (ATL-HPA050112)



Citations for Anti EIF3C pAb (ATL-HPA050112) – 1 Found
Zhao, Weipeng; Li, Xichuan; Wang, Jun; Wang, Chen; Jia, Yongsheng; Yuan, Shunzong; Huang, Yong; Shi, Yehui; Tong, Zhongsheng. Decreasing Eukaryotic Initiation Factor 3C (EIF3C) Suppresses Proliferation and Stimulates Apoptosis in Breast Cancer Cell Lines Through Mammalian Target of Rapamycin (mTOR) Pathway. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2017;23( 28854163):4182-4191.  PubMed