Anti EIF3C pAb (ATL-HPA047097)

Atlas Antibodies

SKU: ATL-HPA047097-25

• 
• 

Protein Description: eukaryotic translation initiation factor 3, subunit C
Gene Name: EIF3C
Alternative Gene Name: eIF3-p110, eIF3c, EIF3S8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030738: 100%, ENSRNOG00000018761: 100%
Entrez Gene ID: 8663
Uniprot ID: Q99613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS
• Gene Sequence: YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS
• Gene ID - Mouse: ENSMUSG00000030738
• Gene ID - Rat: ENSRNOG00000018761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.