Anti EIF2B4 pAb (ATL-HPA039993)
Atlas Antibodies
- SKU:
- ATL-HPA039993-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF2B4
Alternative Gene Name: DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029145: 78%, ENSRNOG00000005301: 77%
Entrez Gene ID: 8890
Uniprot ID: Q9UI10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER |
Gene Sequence | VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER |
Gene ID - Mouse | ENSMUSG00000029145 |
Gene ID - Rat | ENSRNOG00000005301 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993) | |
Datasheet | Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link) |
Vendor Page | Anti EIF2B4 pAb (ATL-HPA039993) at Atlas Antibodies |
Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993) | |
Datasheet | Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link) |
Vendor Page | Anti EIF2B4 pAb (ATL-HPA039993) |