Anti EIF1AD pAb (ATL-HPA058735)

Atlas Antibodies

SKU: ATL-HPA058735-25

• 

Protein Description: eukaryotic translation initiation factor 1A domain containing
Gene Name: EIF1AD
Alternative Gene Name: haponin, MGC11102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024841: 90%, ENSRNOG00000020463: 89%
Entrez Gene ID: 84285
Uniprot ID: Q8N9N8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFV
• Gene Sequence: EEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFV
• Gene ID - Mouse: ENSMUSG00000024841
• Gene ID - Rat: ENSRNOG00000020463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.