Protein Description: EP300 interacting inhibitor of differentiation 2B
Gene Name: EID2B
Alternative Gene Name: EID-3, FLJ38944
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070705: 53%, ENSRNOG00000045545: 56%
Entrez Gene ID: 126272
Uniprot ID: Q96D98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EID2B
Alternative Gene Name: EID-3, FLJ38944
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070705: 53%, ENSRNOG00000045545: 56%
Entrez Gene ID: 126272
Uniprot ID: Q96D98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA |
| Documents & Links for Anti EID2B pAb (ATL-HPA064185) | |
| Datasheet | Anti EID2B pAb (ATL-HPA064185) Datasheet (External Link) |
| Vendor Page | Anti EID2B pAb (ATL-HPA064185) at Atlas |
| Documents & Links for Anti EID2B pAb (ATL-HPA064185) | |
| Datasheet | Anti EID2B pAb (ATL-HPA064185) Datasheet (External Link) |
| Vendor Page | Anti EID2B pAb (ATL-HPA064185) |