Anti EID2 pAb (ATL-HPA045477)

Atlas Antibodies

SKU: ATL-HPA045477-25

• 
• 

Protein Description: EP300 interacting inhibitor of differentiation 2
Gene Name: EID2
Alternative Gene Name: CRI2, EID-2, MGC20452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046058: 90%, ENSRNOG00000019310: 90%
Entrez Gene ID: 163126
Uniprot ID: Q8N6I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE
• Gene Sequence: AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE
• Gene ID - Mouse: ENSMUSG00000046058
• Gene ID - Rat: ENSRNOG00000019310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.