Anti EI24 pAb (ATL-HPA047165)

Atlas Antibodies

SKU: ATL-HPA047165-25

• 
• 

Protein Description: etoposide induced 2.4
Gene Name: EI24
Alternative Gene Name: EPG4, PIG8, TP53I8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062762: 95%, ENSRNOG00000030391: 96%
Entrez Gene ID: 9538
Uniprot ID: O14681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRI
• Gene Sequence: GIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRI
• Gene ID - Mouse: ENSMUSG00000062762
• Gene ID - Rat: ENSRNOG00000030391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.