Anti EHF pAb (ATL-HPA050923)

Atlas Antibodies

SKU:
ATL-HPA050923-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
  • Western blot analysis in human cell line TD47D.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ets homologous factor
Gene Name: EHF
Alternative Gene Name: ESE3, ESEJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012350: 92%, ENSRNOG00000007484: 94%
Entrez Gene ID: 26298
Uniprot ID: Q9NZC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL
Gene Sequence MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL
Gene ID - Mouse ENSMUSG00000012350
Gene ID - Rat ENSRNOG00000007484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EHF pAb (ATL-HPA050923)
Datasheet Anti EHF pAb (ATL-HPA050923) Datasheet (External Link)
Vendor Page Anti EHF pAb (ATL-HPA050923) at Atlas Antibodies

Documents & Links for Anti EHF pAb (ATL-HPA050923)
Datasheet Anti EHF pAb (ATL-HPA050923) Datasheet (External Link)
Vendor Page Anti EHF pAb (ATL-HPA050923)