Anti EHD3 pAb (ATL-HPA049986)

Atlas Antibodies

SKU:
ATL-HPA049986-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: EH-domain containing 3
Gene Name: EHD3
Alternative Gene Name: PAST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024065: 100%, ENSRNOG00000007744: 98%
Entrez Gene ID: 30845
Uniprot ID: Q9NZN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
Gene Sequence PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
Gene ID - Mouse ENSMUSG00000024065
Gene ID - Rat ENSRNOG00000007744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EHD3 pAb (ATL-HPA049986)
Datasheet Anti EHD3 pAb (ATL-HPA049986) Datasheet (External Link)
Vendor Page Anti EHD3 pAb (ATL-HPA049986) at Atlas Antibodies

Documents & Links for Anti EHD3 pAb (ATL-HPA049986)
Datasheet Anti EHD3 pAb (ATL-HPA049986) Datasheet (External Link)
Vendor Page Anti EHD3 pAb (ATL-HPA049986)



Citations for Anti EHD3 pAb (ATL-HPA049986) – 1 Found
Petrosyan, Astgik; Cravedi, Paolo; Villani, Valentina; Angeletti, Andrea; Manrique, Joaquin; Renieri, Alessandra; De Filippo, Roger E; Perin, Laura; Da Sacco, Stefano. A glomerulus-on-a-chip to recapitulate the human glomerular filtration barrier. Nature Communications. 2019;10(1):3656.  PubMed