Anti EGLN2 pAb (ATL-HPA056649)

Atlas Antibodies

SKU: ATL-HPA056649-25

• 

Protein Description: egl-9 family hypoxia-inducible factor 2
Gene Name: EGLN2
Alternative Gene Name: HIFPH1, PHD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058709: 78%, ENSRNOG00000020947: 79%
Entrez Gene ID: 112398
Uniprot ID: Q96KS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
• Gene Sequence: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
• Gene ID - Mouse: ENSMUSG00000058709
• Gene ID - Rat: ENSRNOG00000020947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.