Anti EGFLAM pAb (ATL-HPA066577)

Atlas Antibodies

SKU:
ATL-HPA066577-25
  • Immunohistochemical staining of human retina shows strong positivity in outer plexiform layer.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EGF like, fibronectin type III and laminin G domains
Gene Name: EGFLAM
Alternative Gene Name: AGRINL, AGRNL, FLJ39155, PIKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042961: 95%, ENSRNOG00000012058: 93%
Entrez Gene ID: 133584
Uniprot ID: Q63HQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA
Gene Sequence GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA
Gene ID - Mouse ENSMUSG00000042961
Gene ID - Rat ENSRNOG00000012058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EGFLAM pAb (ATL-HPA066577)
Datasheet Anti EGFLAM pAb (ATL-HPA066577) Datasheet (External Link)
Vendor Page Anti EGFLAM pAb (ATL-HPA066577) at Atlas Antibodies

Documents & Links for Anti EGFLAM pAb (ATL-HPA066577)
Datasheet Anti EGFLAM pAb (ATL-HPA066577) Datasheet (External Link)
Vendor Page Anti EGFLAM pAb (ATL-HPA066577)