![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99852/179545/atl-hpa066577_anti-egflam-pab-atl-hpa066577_61207__81493.1681135262.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: EGF like, fibronectin type III and laminin G domains
Gene Name: EGFLAM
Alternative Gene Name: AGRINL, AGRNL, FLJ39155, PIKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042961: 95%, ENSRNOG00000012058: 93%
Entrez Gene ID: 133584
Uniprot ID: Q63HQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EGFLAM
Alternative Gene Name: AGRINL, AGRNL, FLJ39155, PIKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042961: 95%, ENSRNOG00000012058: 93%
Entrez Gene ID: 133584
Uniprot ID: Q63HQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENA |
| Documents & Links for Anti EGFLAM pAb (ATL-HPA066577) | |
| Datasheet | Anti EGFLAM pAb (ATL-HPA066577) Datasheet (External Link) |
| Vendor Page | Anti EGFLAM pAb (ATL-HPA066577) at Atlas |
| Documents & Links for Anti EGFLAM pAb (ATL-HPA066577) | |
| Datasheet | Anti EGFLAM pAb (ATL-HPA066577) Datasheet (External Link) |
| Vendor Page | Anti EGFLAM pAb (ATL-HPA066577) |