Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA070841-25
  • Immunohistochemistry analysis in human placenta and liver tissues using HPA070841 antibody. Corresponding EFEMP1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: EGF containing fibulin-like extracellular matrix protein 1
Gene Name: EFEMP1
Alternative Gene Name: DHRD, FBLN3, FBNL, MTLV, S1-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020467: 94%, ENSRNOG00000003553: 93%
Entrez Gene ID: 2202
Uniprot ID: Q12805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
Gene Sequence RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
Gene ID - Mouse ENSMUSG00000020467
Gene ID - Rat ENSRNOG00000003553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation)
Datasheet Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation)