Protein Description: EGF containing fibulin-like extracellular matrix protein 1
Gene Name: EFEMP1
Alternative Gene Name: DHRD, FBLN3, FBNL, MTLV, S1-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020467: 94%, ENSRNOG00000003553: 93%
Entrez Gene ID: 2202
Uniprot ID: Q12805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EFEMP1
Alternative Gene Name: DHRD, FBLN3, FBNL, MTLV, S1-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020467: 94%, ENSRNOG00000003553: 93%
Entrez Gene ID: 2202
Uniprot ID: Q12805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG |
Documents & Links for Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) | |
Datasheet | Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) at Atlas |
Documents & Links for Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) | |
Datasheet | Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation) |