Anti EFCAB11 pAb (ATL-HPA051209)
Atlas Antibodies
- SKU:
- ATL-HPA051209-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EFCAB11
Alternative Gene Name: C14orf143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021176: 80%, ENSRNOG00000053317: 80%
Entrez Gene ID: 90141
Uniprot ID: Q9BUY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS |
Gene Sequence | MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSS |
Gene ID - Mouse | ENSMUSG00000021176 |
Gene ID - Rat | ENSRNOG00000053317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209) | |
Datasheet | Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link) |
Vendor Page | Anti EFCAB11 pAb (ATL-HPA051209) at Atlas Antibodies |
Documents & Links for Anti EFCAB11 pAb (ATL-HPA051209) | |
Datasheet | Anti EFCAB11 pAb (ATL-HPA051209) Datasheet (External Link) |
Vendor Page | Anti EFCAB11 pAb (ATL-HPA051209) |