Anti EEF1G pAb (ATL-HPA055316 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055316-25

• 

Protein Description: eukaryotic translation elongation factor 1 gamma
Gene Name: EEF1G
Alternative Gene Name: EF1G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071644: 100%, ENSRNOG00000020075: 99%
Entrez Gene ID: 1937
Uniprot ID: P26641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI
• Gene Sequence: YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI
• Gene ID - Mouse: ENSMUSG00000071644
• Gene ID - Rat: ENSRNOG00000020075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.