Anti EEF1D pAb (ATL-HPA051002)

Atlas Antibodies

SKU: ATL-HPA051002-25

• 
• 

Protein Description: eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
Gene Name: EEF1D
Alternative Gene Name: EF-1D, FLJ20897
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055762: 80%, ENSRNOG00000021638: 81%
Entrez Gene ID: 1936
Uniprot ID: P29692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
• Gene Sequence: PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
• Gene ID - Mouse: ENSMUSG00000055762
• Gene ID - Rat: ENSRNOG00000021638
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.