Anti EEF1AKMT3 pAb (ATL-HPA045492)

Atlas Antibodies

SKU: ATL-HPA045492-25

• 

Protein Description: EEF1A lysine methyltransferase 3
Gene Name: EEF1AKMT3
Alternative Gene Name: DKFZP586D0919, FAM119B, METTL21B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000080115: 87%, ENSRNOG00000047631: 88%
Entrez Gene ID: 25895
Uniprot ID: Q96AZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPT
• Gene Sequence: GILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPT
• Gene ID - Mouse: ENSMUSG00000080115
• Gene ID - Rat: ENSRNOG00000047631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.