Anti EEF1A1 pAb (ATL-HPA051759)

Atlas Antibodies

SKU: ATL-HPA051759-100

• 
• 
• 

Protein Description: eukaryotic translation elongation factor 1 alpha 1
Gene Name: EEF1A1
Alternative Gene Name: EE1A1, EEF1A, EF1A, LENG7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016349: 100%, ENSRNOG00000012477: 100%
Entrez Gene ID: 1915
Uniprot ID: P68104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
• Gene Sequence: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
• Gene ID - Mouse: ENSMUSG00000016349
• Gene ID - Rat: ENSRNOG00000012477
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.