Anti EDEM2 pAb (ATL-HPA048353)

Atlas Antibodies

SKU:
ATL-HPA048353-25
  • Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ER degradation enhancer, mannosidase alpha-like 2
Gene Name: EDEM2
Alternative Gene Name: bA4204.1, C20orf31, C20orf49, FLJ10783
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038312: 80%, ENSRNOG00000019299: 84%
Entrez Gene ID: 55741
Uniprot ID: Q9BV94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQRLKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSP
Gene Sequence FDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQRLKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSP
Gene ID - Mouse ENSMUSG00000038312
Gene ID - Rat ENSRNOG00000019299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDEM2 pAb (ATL-HPA048353)
Datasheet Anti EDEM2 pAb (ATL-HPA048353) Datasheet (External Link)
Vendor Page Anti EDEM2 pAb (ATL-HPA048353) at Atlas Antibodies

Documents & Links for Anti EDEM2 pAb (ATL-HPA048353)
Datasheet Anti EDEM2 pAb (ATL-HPA048353) Datasheet (External Link)
Vendor Page Anti EDEM2 pAb (ATL-HPA048353)