Anti EDDM3A pAb (ATL-HPA049952)
Atlas Antibodies
- SKU:
- ATL-HPA049952-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EDDM3A
Alternative Gene Name: FAM12A, HE3-ALPHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072575: 49%, ENSRNOG00000054022: 46%
Entrez Gene ID: 10876
Uniprot ID: Q14507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS |
Gene Sequence | KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS |
Gene ID - Mouse | ENSMUSG00000072575 |
Gene ID - Rat | ENSRNOG00000054022 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EDDM3A pAb (ATL-HPA049952) | |
Datasheet | Anti EDDM3A pAb (ATL-HPA049952) Datasheet (External Link) |
Vendor Page | Anti EDDM3A pAb (ATL-HPA049952) at Atlas Antibodies |
Documents & Links for Anti EDDM3A pAb (ATL-HPA049952) | |
Datasheet | Anti EDDM3A pAb (ATL-HPA049952) Datasheet (External Link) |
Vendor Page | Anti EDDM3A pAb (ATL-HPA049952) |