Anti EDDM3A pAb (ATL-HPA049952)

Atlas Antibodies

SKU:
ATL-HPA049952-25
  • Immunohistochemical staining of human epididymis shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: epididymal protein 3A
Gene Name: EDDM3A
Alternative Gene Name: FAM12A, HE3-ALPHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072575: 49%, ENSRNOG00000054022: 46%
Entrez Gene ID: 10876
Uniprot ID: Q14507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
Gene Sequence KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
Gene ID - Mouse ENSMUSG00000072575
Gene ID - Rat ENSRNOG00000054022
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EDDM3A pAb (ATL-HPA049952)
Datasheet Anti EDDM3A pAb (ATL-HPA049952) Datasheet (External Link)
Vendor Page Anti EDDM3A pAb (ATL-HPA049952) at Atlas Antibodies

Documents & Links for Anti EDDM3A pAb (ATL-HPA049952)
Datasheet Anti EDDM3A pAb (ATL-HPA049952) Datasheet (External Link)
Vendor Page Anti EDDM3A pAb (ATL-HPA049952)