Protein Description: endothelial cell surface expressed chemotaxis and apoptosis regulator
Gene Name: ECSCR
Alternative Gene Name: ARIA, ECSM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090588: 40%, ENSRNOG00000005564: 37%
Entrez Gene ID: 641700
Uniprot ID: Q19T08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ECSCR
Alternative Gene Name: ARIA, ECSM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090588: 40%, ENSRNOG00000005564: 37%
Entrez Gene ID: 641700
Uniprot ID: Q19T08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT |
| Documents & Links for Anti ECSCR pAb (ATL-HPA063337) | |
| Datasheet | Anti ECSCR pAb (ATL-HPA063337) Datasheet (External Link) |
| Vendor Page | Anti ECSCR pAb (ATL-HPA063337) at Atlas |
| Documents & Links for Anti ECSCR pAb (ATL-HPA063337) | |
| Datasheet | Anti ECSCR pAb (ATL-HPA063337) Datasheet (External Link) |
| Vendor Page | Anti ECSCR pAb (ATL-HPA063337) |