Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046635-25
  • Immunohistochemistry analysis in human placenta and prostate tissues using HPA046635 antibody. Corresponding EBI3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Epstein-Barr virus induced 3
Gene Name: EBI3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003206: 63%, ENSRNOG00000050509: 63%
Entrez Gene ID: 10148
Uniprot ID: Q14213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV
Gene Sequence SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV
Gene ID - Mouse ENSMUSG00000003206
Gene ID - Rat ENSRNOG00000050509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation)
Datasheet Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation)
Datasheet Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation)



Citations for Anti EBI3 pAb (ATL-HPA046635 w/enhanced validation) – 2 Found
Mirlekar, Bhalchandra; Michaud, Daniel; Searcy, Ryan; Greene, Kevin; Pylayeva-Gupta, Yuliya. IL35 Hinders Endogenous Antitumor T-cell Immunity and Responsiveness to Immunotherapy in Pancreatic Cancer. Cancer Immunology Research. 2018;6(9):1014-1024.  PubMed
Mirlekar, Bhalchandra; Wang, Yan; Li, Sirui; Zhou, Mi; Entwistle, Sarah; De Buysscher, Tristan; Morrison, Ashley; Herrera, Gabriela; Harris, Cameron; Vincent, Benjamin G; Ting, Jenny P-Y; Rashid, Naim; Kim, William Y; Yeh, Jen Jen; Pylayeva-Gupta, Yuliya. Balance between immunoregulatory B cells and plasma cells drives pancreatic tumor immunity. Cell Reports. Medicine. 2022;3(9):100744.  PubMed