Protein Description: early B cell factor 2
Gene Name: EBF2
Alternative Gene Name: COE2, FLJ11500
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022053: 100%, ENSRNOG00000011548: 100%
Entrez Gene ID: 64641
Uniprot ID: Q9HAK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EBF2
Alternative Gene Name: COE2, FLJ11500
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022053: 100%, ENSRNOG00000011548: 100%
Entrez Gene ID: 64641
Uniprot ID: Q9HAK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF |
| Gene ID - Mouse | ENSMUSG00000022053 |
| Gene ID - Rat | ENSMUSG00000022053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EBF2 pAb (ATL-HPA055101) | |
| Datasheet | Anti EBF2 pAb (ATL-HPA055101) Datasheet (External Link) |
| Vendor Page | Anti EBF2 pAb (ATL-HPA055101) at Atlas |
| Documents & Links for Anti EBF2 pAb (ATL-HPA055101) | |
| Datasheet | Anti EBF2 pAb (ATL-HPA055101) Datasheet (External Link) |
| Vendor Page | Anti EBF2 pAb (ATL-HPA055101) |