Protein Description: E2F transcription factor 8
Gene Name: E2F8
Alternative Gene Name: FLJ23311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046179: 77%, ENSRNOG00000022537: 79%
Entrez Gene ID: 79733
Uniprot ID: A0AVK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: E2F8
Alternative Gene Name: FLJ23311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046179: 77%, ENSRNOG00000022537: 79%
Entrez Gene ID: 79733
Uniprot ID: A0AVK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIKTNKAESSQNSAPFPSKMAQLA |
| Documents & Links for Anti E2F8 pAb (ATL-HPA076614) | |
| Datasheet | Anti E2F8 pAb (ATL-HPA076614) Datasheet (External Link) |
| Vendor Page | Anti E2F8 pAb (ATL-HPA076614) at Atlas |
| Documents & Links for Anti E2F8 pAb (ATL-HPA076614) | |
| Datasheet | Anti E2F8 pAb (ATL-HPA076614) Datasheet (External Link) |
| Vendor Page | Anti E2F8 pAb (ATL-HPA076614) |