Anti E2F8 pAb (ATL-HPA064882)

Atlas Antibodies

SKU: ATL-HPA064882-25

• 

Protein Description: E2F transcription factor 8
Gene Name: E2F8
Alternative Gene Name: FLJ23311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046179: 80%, ENSRNOG00000022537: 80%
Entrez Gene ID: 79733
Uniprot ID: A0AVK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV
• Gene Sequence: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV
• Gene ID - Mouse: ENSMUSG00000046179
• Gene ID - Rat: ENSRNOG00000022537
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti E2F8 pAb (ATL-HPA064882) – 1 Found

Zhang, Zhiqiao; Li, Jing; He, Tingshan; Ouyang, Yanling; Huang, Yiyan; Liu, Qingbo; Wang, Peng; Ding, Jianqiang. Two predictive precision medicine tools for hepatocellular carcinoma. Cancer Cell International. 19( 31754347):290.