Protein Description: E2F transcription factor 5
Gene Name: E2F5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027552: 96%, ENSRNOG00000010760: 96%
Entrez Gene ID: 1875
Uniprot ID: Q15329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: E2F5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027552: 96%, ENSRNOG00000010760: 96%
Entrez Gene ID: 1875
Uniprot ID: Q15329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GCNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRF |
| Documents & Links for Anti E2F5 pAb (ATL-HPA065441) | |
| Datasheet | Anti E2F5 pAb (ATL-HPA065441) Datasheet (External Link) |
| Vendor Page | Anti E2F5 pAb (ATL-HPA065441) at Atlas |
| Documents & Links for Anti E2F5 pAb (ATL-HPA065441) | |
| Datasheet | Anti E2F5 pAb (ATL-HPA065441) Datasheet (External Link) |
| Vendor Page | Anti E2F5 pAb (ATL-HPA065441) |