Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Gene Name: DYRK3
Alternative Gene Name: hYAK3-2, RED, REDK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016526: 74%, ENSRNOG00000004870: 75%
Entrez Gene ID: 8444
Uniprot ID: O43781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DYRK3
Alternative Gene Name: hYAK3-2, RED, REDK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016526: 74%, ENSRNOG00000004870: 75%
Entrez Gene ID: 8444
Uniprot ID: O43781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ |
| Documents & Links for Anti DYRK3 pAb (ATL-HPA075041) | |
| Datasheet | Anti DYRK3 pAb (ATL-HPA075041) Datasheet (External Link) |
| Vendor Page | Anti DYRK3 pAb (ATL-HPA075041) at Atlas |
| Documents & Links for Anti DYRK3 pAb (ATL-HPA075041) | |
| Datasheet | Anti DYRK3 pAb (ATL-HPA075041) Datasheet (External Link) |
| Vendor Page | Anti DYRK3 pAb (ATL-HPA075041) |