Anti DYRK3 pAb (ATL-HPA075041)

Atlas Antibodies

SKU: ATL-HPA075041-25

• 

Protein Description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Gene Name: DYRK3
Alternative Gene Name: hYAK3-2, RED, REDK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016526: 74%, ENSRNOG00000004870: 75%
Entrez Gene ID: 8444
Uniprot ID: O43781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
• Gene Sequence: GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
• Gene ID - Mouse: ENSMUSG00000016526
• Gene ID - Rat: ENSRNOG00000004870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.