Anti DXO pAb (ATL-HPA046708)

Atlas Antibodies

SKU:
ATL-HPA046708-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: decapping exoribonuclease
Gene Name: DXO
Alternative Gene Name: DOM3Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040482: 85%, ENSRNOG00000000422: 87%
Entrez Gene ID: 1797
Uniprot ID: O77932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDR
Gene Sequence GTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDR
Gene ID - Mouse ENSMUSG00000040482
Gene ID - Rat ENSRNOG00000000422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DXO pAb (ATL-HPA046708)
Datasheet Anti DXO pAb (ATL-HPA046708) Datasheet (External Link)
Vendor Page Anti DXO pAb (ATL-HPA046708) at Atlas Antibodies

Documents & Links for Anti DXO pAb (ATL-HPA046708)
Datasheet Anti DXO pAb (ATL-HPA046708) Datasheet (External Link)
Vendor Page Anti DXO pAb (ATL-HPA046708)