Anti DUSP28 pAb (ATL-HPA047456)

Atlas Antibodies

SKU: ATL-HPA047456-25

• 

Protein Description: dual specificity phosphatase 28
Gene Name: DUSP28
Alternative Gene Name: DUSP26, VHP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047067: 74%, ENSRNOG00000057389: 74%
Entrez Gene ID: 285193
Uniprot ID: Q4G0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: GACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA
• Gene ID - Mouse: ENSMUSG00000047067
• Gene ID - Rat: ENSMUSG00000047067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.