Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018221-100

• 
• 
• 

Protein Description: dual specificity phosphatase 26 (putative)
Gene Name: DUSP26
Alternative Gene Name: DUSP24, MGC1136
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039661: 96%, ENSRNOG00000011518: 97%
Entrez Gene ID: 78986
Uniprot ID: Q9BV47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL
• Gene Sequence: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL
• Gene ID - Mouse: ENSMUSG00000039661
• Gene ID - Rat: ENSRNOG00000011518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DUSP26 pAb (ATL-HPA018221 w/enhanced validation) – 1 Found

Bourgonje, Annika M; Verrijp, Kiek; Schepens, Jan T G; Navis, Anna C; Piepers, Jolanda A F; Palmen, Chantal B C; van den Eijnden, Monique; Hooft van Huijsduijnen, Rob; Wesseling, Pieter; Leenders, William P J; Hendriks, Wiljan J A J. Comprehensive protein tyrosine phosphatase mRNA profiling identifies new regulators in the progression of glioma. Acta Neuropathologica Communications. 2016;4(1):96.