Anti DUSP23 pAb (ATL-HPA045792)

Atlas Antibodies

SKU: ATL-HPA045792-25

• 
• 

Protein Description: dual specificity phosphatase 23
Gene Name: DUSP23
Alternative Gene Name: DUSP25, FLJ20442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026544: 99%, ENSRNOG00000022143: 97%
Entrez Gene ID: 54935
Uniprot ID: Q9BVJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
• Gene Sequence: IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
• Gene ID - Mouse: ENSMUSG00000026544
• Gene ID - Rat: ENSRNOG00000022143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.