Anti DTWD2 pAb (ATL-HPA053173)

Atlas Antibodies

SKU:
ATL-HPA053173-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DTW domain containing 2
Gene Name: DTWD2
Alternative Gene Name: FLJ33977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024505: 95%, ENSRNOG00000059142: 92%
Entrez Gene ID: 285605
Uniprot ID: Q8NBA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVYPSTIIIIDGTWSQAKDIFYKNSLFRHPKQVQLKTSISSQYVIRMQPTNRCLSTLECAAVALSILEKNNYIQETLLRPLQALCSFQLQHGAQI
Gene Sequence PVYPSTIIIIDGTWSQAKDIFYKNSLFRHPKQVQLKTSISSQYVIRMQPTNRCLSTLECAAVALSILEKNNYIQETLLRPLQALCSFQLQHGAQI
Gene ID - Mouse ENSMUSG00000024505
Gene ID - Rat ENSRNOG00000059142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DTWD2 pAb (ATL-HPA053173)
Datasheet Anti DTWD2 pAb (ATL-HPA053173) Datasheet (External Link)
Vendor Page Anti DTWD2 pAb (ATL-HPA053173) at Atlas Antibodies

Documents & Links for Anti DTWD2 pAb (ATL-HPA053173)
Datasheet Anti DTWD2 pAb (ATL-HPA053173) Datasheet (External Link)
Vendor Page Anti DTWD2 pAb (ATL-HPA053173)