Anti DSEL pAb (ATL-HPA060942)

Atlas Antibodies

SKU:
ATL-HPA060942-100
  • Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: dermatan sulfate epimerase-like
Gene Name: DSEL
Alternative Gene Name: C18orf4, FLJ11477, NCAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038702: 94%, ENSRNOG00000032307: 92%
Entrez Gene ID: 92126
Uniprot ID: Q8IZU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTGEEVGDAAGEIITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA
Gene Sequence WTGEEVGDAAGEIITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA
Gene ID - Mouse ENSMUSG00000038702
Gene ID - Rat ENSRNOG00000032307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DSEL pAb (ATL-HPA060942)
Datasheet Anti DSEL pAb (ATL-HPA060942) Datasheet (External Link)
Vendor Page Anti DSEL pAb (ATL-HPA060942) at Atlas Antibodies

Documents & Links for Anti DSEL pAb (ATL-HPA060942)
Datasheet Anti DSEL pAb (ATL-HPA060942) Datasheet (External Link)
Vendor Page Anti DSEL pAb (ATL-HPA060942)