Anti DR1 pAb (ATL-HPA055308 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055308-25

• 
• 
• 

Protein Description: down-regulator of transcription 1, TBP-binding (negative cofactor 2)
Gene Name: DR1
Alternative Gene Name: NC2, NC2-BETA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029265: 100%, ENSRNOG00000048308: 100%
Entrez Gene ID: 1810
Uniprot ID: Q01658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ
• Gene Sequence: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ
• Gene ID - Mouse: ENSMUSG00000029265
• Gene ID - Rat: ENSRNOG00000048308
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.