Anti DPYSL4 pAb (ATL-HPA049066)

Atlas Antibodies

SKU:
ATL-HPA049066-100
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Cerebral Cortex tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: dihydropyrimidinase-like 4
Gene Name: DPYSL4
Alternative Gene Name: DRP-4, ULIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111393: 89%, ENSRNOG00000027582: 92%
Entrez Gene ID: 10570
Uniprot ID: O14531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH
Gene Sequence YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH
Gene ID - Mouse ENSMUSG00000111393
Gene ID - Rat ENSRNOG00000027582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPYSL4 pAb (ATL-HPA049066)
Datasheet Anti DPYSL4 pAb (ATL-HPA049066) Datasheet (External Link)
Vendor Page Anti DPYSL4 pAb (ATL-HPA049066) at Atlas Antibodies

Documents & Links for Anti DPYSL4 pAb (ATL-HPA049066)
Datasheet Anti DPYSL4 pAb (ATL-HPA049066) Datasheet (External Link)
Vendor Page Anti DPYSL4 pAb (ATL-HPA049066)