Anti DPYSL4 pAb (ATL-HPA049066)
Atlas Antibodies
- SKU:
- ATL-HPA049066-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DPYSL4
Alternative Gene Name: DRP-4, ULIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111393: 89%, ENSRNOG00000027582: 92%
Entrez Gene ID: 10570
Uniprot ID: O14531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH |
Gene Sequence | YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH |
Gene ID - Mouse | ENSMUSG00000111393 |
Gene ID - Rat | ENSRNOG00000027582 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPYSL4 pAb (ATL-HPA049066) | |
Datasheet | Anti DPYSL4 pAb (ATL-HPA049066) Datasheet (External Link) |
Vendor Page | Anti DPYSL4 pAb (ATL-HPA049066) at Atlas Antibodies |
Documents & Links for Anti DPYSL4 pAb (ATL-HPA049066) | |
Datasheet | Anti DPYSL4 pAb (ATL-HPA049066) Datasheet (External Link) |
Vendor Page | Anti DPYSL4 pAb (ATL-HPA049066) |