Anti DPY19L2 pAb (ATL-HPA078305 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA078305-25

• 

Product Description

Protein Description: dpy-19 like 2
Gene Name: DPY19L2
Alternative Gene Name: FLJ32949, SPATA34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063952: 37%, ENSRNOG00000028641: 37%
Entrez Gene ID: 283417
Uniprot ID: Q6NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM
• Gene Sequence: KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM
• Gene ID - Mouse: ENSMUSG00000063952
• Gene ID - Rat: ENSRNOG00000028641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links