Protein Description: developmental pluripotency associated 5
Gene Name: DPPA5
Alternative Gene Name: Esg1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060461: 73%, ENSRNOG00000060610: 75%
Entrez Gene ID: 340168
Uniprot ID: A6NC42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DPPA5
Alternative Gene Name: Esg1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060461: 73%, ENSRNOG00000060610: 75%
Entrez Gene ID: 340168
Uniprot ID: A6NC42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS |
| Documents & Links for Anti DPPA5 pAb (ATL-HPA064505) | |
| Datasheet | Anti DPPA5 pAb (ATL-HPA064505) Datasheet (External Link) |
| Vendor Page | Anti DPPA5 pAb (ATL-HPA064505) at Atlas |
| Documents & Links for Anti DPPA5 pAb (ATL-HPA064505) | |
| Datasheet | Anti DPPA5 pAb (ATL-HPA064505) Datasheet (External Link) |
| Vendor Page | Anti DPPA5 pAb (ATL-HPA064505) |