Anti DPP10 pAb (ATL-HPA048767)

Atlas Antibodies

SKU:
ATL-HPA048767-25
  • Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dipeptidyl-peptidase 10 (non-functional)
Gene Name: DPP10
Alternative Gene Name: DPRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036815: 83%, ENSRNOG00000002595: 82%
Entrez Gene ID: 57628
Uniprot ID: Q8N608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK
Gene Sequence GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKK
Gene ID - Mouse ENSMUSG00000036815
Gene ID - Rat ENSRNOG00000002595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPP10 pAb (ATL-HPA048767)
Datasheet Anti DPP10 pAb (ATL-HPA048767) Datasheet (External Link)
Vendor Page Anti DPP10 pAb (ATL-HPA048767) at Atlas Antibodies

Documents & Links for Anti DPP10 pAb (ATL-HPA048767)
Datasheet Anti DPP10 pAb (ATL-HPA048767) Datasheet (External Link)
Vendor Page Anti DPP10 pAb (ATL-HPA048767)