Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049148-25
  • Immunohistochemistry analysis in human cerebral cortex and cervix, uterine tissues using HPA049148 antibody. Corresponding DPF1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: D4, zinc and double PHD fingers family 1
Gene Name: DPF1
Alternative Gene Name: BAF45b, NEUD4, neuro-d4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030584: 96%, ENSRNOG00000020687: 96%
Entrez Gene ID: 8193
Uniprot ID: Q92782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
Gene Sequence VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
Gene ID - Mouse ENSMUSG00000030584
Gene ID - Rat ENSRNOG00000020687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation)
Datasheet Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation)
Datasheet Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPF1 pAb (ATL-HPA049148 w/enhanced validation)