Protein Description: DOT1-like histone H3K79 methyltransferase
Gene Name: DOT1L
Alternative Gene Name: DOT1, KIAA1814, KMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061589: 99%, ENSRNOG00000032546: 99%
Entrez Gene ID: 84444
Uniprot ID: Q8TEK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOT1L
Alternative Gene Name: DOT1, KIAA1814, KMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061589: 99%, ENSRNOG00000032546: 99%
Entrez Gene ID: 84444
Uniprot ID: Q8TEK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS |
| Documents & Links for Anti DOT1L pAb (ATL-HPA071217) | |
| Datasheet | Anti DOT1L pAb (ATL-HPA071217) Datasheet (External Link) |
| Vendor Page | Anti DOT1L pAb (ATL-HPA071217) at Atlas |
| Documents & Links for Anti DOT1L pAb (ATL-HPA071217) | |
| Datasheet | Anti DOT1L pAb (ATL-HPA071217) Datasheet (External Link) |
| Vendor Page | Anti DOT1L pAb (ATL-HPA071217) |