Protein Description: docking protein 5
Gene Name: DOK5
Alternative Gene Name: C20orf180, dJ805C22.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027560: 95%, ENSRNOG00000013196: 92%
Entrez Gene ID: 55816
Uniprot ID: Q9P104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DOK5
Alternative Gene Name: C20orf180, dJ805C22.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027560: 95%, ENSRNOG00000013196: 92%
Entrez Gene ID: 55816
Uniprot ID: Q9P104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EQHERLLQSVKNSMLQMKMSERAASLSTMVPLPRSAY |
| Documents & Links for Anti DOK5 pAb (ATL-HPA065235) | |
| Datasheet | Anti DOK5 pAb (ATL-HPA065235) Datasheet (External Link) |
| Vendor Page | Anti DOK5 pAb (ATL-HPA065235) at Atlas |
| Documents & Links for Anti DOK5 pAb (ATL-HPA065235) | |
| Datasheet | Anti DOK5 pAb (ATL-HPA065235) Datasheet (External Link) |
| Vendor Page | Anti DOK5 pAb (ATL-HPA065235) |