Anti DOK4 pAb (ATL-HPA055849)

Atlas Antibodies

SKU:
ATL-HPA055849-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to microtubules & cytokinetic bridge.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: docking protein 4
Gene Name: DOK4
Alternative Gene Name: FLJ10488
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040631: 100%, ENSRNOG00000015679: 100%
Entrez Gene ID: 55715
Uniprot ID: Q8TEW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSEL
Gene Sequence QRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSEL
Gene ID - Mouse ENSMUSG00000040631
Gene ID - Rat ENSRNOG00000015679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOK4 pAb (ATL-HPA055849)
Datasheet Anti DOK4 pAb (ATL-HPA055849) Datasheet (External Link)
Vendor Page Anti DOK4 pAb (ATL-HPA055849) at Atlas Antibodies

Documents & Links for Anti DOK4 pAb (ATL-HPA055849)
Datasheet Anti DOK4 pAb (ATL-HPA055849) Datasheet (External Link)
Vendor Page Anti DOK4 pAb (ATL-HPA055849)