Anti DOK1 pAb (ATL-HPA048561)

Atlas Antibodies

SKU:
ATL-HPA048561-25
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: docking protein 1, 62kDa (downstream of tyrosine kinase 1)
Gene Name: DOK1
Alternative Gene Name: p62dok
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068335: 77%, ENSRNOG00000007412: 79%
Entrez Gene ID: 1796
Uniprot ID: Q99704
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEG
Gene Sequence AQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEG
Gene ID - Mouse ENSMUSG00000068335
Gene ID - Rat ENSRNOG00000007412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOK1 pAb (ATL-HPA048561)
Datasheet Anti DOK1 pAb (ATL-HPA048561) Datasheet (External Link)
Vendor Page Anti DOK1 pAb (ATL-HPA048561) at Atlas Antibodies

Documents & Links for Anti DOK1 pAb (ATL-HPA048561)
Datasheet Anti DOK1 pAb (ATL-HPA048561) Datasheet (External Link)
Vendor Page Anti DOK1 pAb (ATL-HPA048561)