Anti DOCK6 pAb (ATL-HPA049424)

Atlas Antibodies

SKU:
ATL-HPA049424-25
  • Immunohistochemical staining of human lung shows moderate granular cytoplamsic positivity in macrophages.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 6
Gene Name: DOCK6
Alternative Gene Name: KIAA1395, ZIR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032198: 87%, ENSRNOG00000010652: 86%
Entrez Gene ID: 57572
Uniprot ID: Q96HP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAFEAMAHVVSLVHRSLEAAQDARGHCPQLAAYVHYAFRLPGTEPSLPDGAPPVTVQAATLARGSGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRILA
Gene Sequence GAFEAMAHVVSLVHRSLEAAQDARGHCPQLAAYVHYAFRLPGTEPSLPDGAPPVTVQAATLARGSGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRILA
Gene ID - Mouse ENSMUSG00000032198
Gene ID - Rat ENSRNOG00000010652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOCK6 pAb (ATL-HPA049424)
Datasheet Anti DOCK6 pAb (ATL-HPA049424) Datasheet (External Link)
Vendor Page Anti DOCK6 pAb (ATL-HPA049424) at Atlas Antibodies

Documents & Links for Anti DOCK6 pAb (ATL-HPA049424)
Datasheet Anti DOCK6 pAb (ATL-HPA049424) Datasheet (External Link)
Vendor Page Anti DOCK6 pAb (ATL-HPA049424)