Anti DOCK6 pAb (ATL-HPA049423)

Atlas Antibodies

SKU:
ATL-HPA049423-25
  • Immunohistochemical staining of human skin shows strong granular cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 6
Gene Name: DOCK6
Alternative Gene Name: KIAA1395, ZIR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032198: 88%, ENSRNOG00000010652: 90%
Entrez Gene ID: 57572
Uniprot ID: Q96HP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL
Gene Sequence LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL
Gene ID - Mouse ENSMUSG00000032198
Gene ID - Rat ENSRNOG00000010652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOCK6 pAb (ATL-HPA049423)
Datasheet Anti DOCK6 pAb (ATL-HPA049423) Datasheet (External Link)
Vendor Page Anti DOCK6 pAb (ATL-HPA049423) at Atlas Antibodies

Documents & Links for Anti DOCK6 pAb (ATL-HPA049423)
Datasheet Anti DOCK6 pAb (ATL-HPA049423) Datasheet (External Link)
Vendor Page Anti DOCK6 pAb (ATL-HPA049423)



Citations for Anti DOCK6 pAb (ATL-HPA049423) – 1 Found
Li, Xiaowei; Jiang, Mingzuo; Chen, Di; Xu, Bing; Wang, Rui; Chu, Yi; Wang, Weijie; Zhou, Lin; Lei, Zhijie; Nie, Yongzhan; Fan, Daiming; Shang, Yulong; Wu, Kaichun; Liang, Jie. miR-148b-3p inhibits gastric cancer metastasis by inhibiting the Dock6/Rac1/Cdc42 axis. Journal Of Experimental & Clinical Cancer Research : Cr. 2018;37(1):71.  PubMed