Anti DOCK11 pAb (ATL-HPA059695)

Atlas Antibodies

SKU:
ATL-HPA059695-25
  • Immunohistochemical staining of human placenta shows moderate positivity in nuclear membrane in trophoblastic cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoli & nuclear membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 11
Gene Name: DOCK11
Alternative Gene Name: ACG, FLJ32122, FLJ43653, ZIZ2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031093: 94%, ENSRNOG00000013321: 94%
Entrez Gene ID: 139818
Uniprot ID: Q5JSL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF
Gene Sequence KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF
Gene ID - Mouse ENSMUSG00000031093
Gene ID - Rat ENSRNOG00000013321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOCK11 pAb (ATL-HPA059695)
Datasheet Anti DOCK11 pAb (ATL-HPA059695) Datasheet (External Link)
Vendor Page Anti DOCK11 pAb (ATL-HPA059695) at Atlas Antibodies

Documents & Links for Anti DOCK11 pAb (ATL-HPA059695)
Datasheet Anti DOCK11 pAb (ATL-HPA059695) Datasheet (External Link)
Vendor Page Anti DOCK11 pAb (ATL-HPA059695)